GenomeNet

>ppf:Pput_0592 K00627 pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12] | (GenBank) alpha/beta hydrolase fold protein (A)
MSQIHTLTMPKWGLSMTEGRVDTWLKQEGDEISKGDEVLDVETDKISSSVEAPFSGVLRR
QVAKPDETLPVGALLAVVVEGEAEESEIDAVVQRFQAEFVAEGGADQSQGPAPQKAEVGG
RLLRWFELGEGGTPLVLVHGFGGDLNNWLFNHPALAAERRVIALDLPGHGESAKALQRGD
LDELSETVLALLDHLDIAKAHLAGHSMGGAVSLNVARLAPQRVASLSLVASAGLGEAING
QYLQGFVTAANRNALKPQMVQLFADPALVTRQMLEDMLKFKRLEGVDQALQQLARALADG
DRQRHDLRGVLGNHPALVVWGGKDAIIPASHAEGLEAEVLVLPEAGHMVQMEAAEQVNQQ
LLAFLRKH

BLAST