GenomeNet

>ppf:Pput_0592 alpha/beta hydrolase fold protein; K00627 pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12] (A)
MSQIHTLTMPKWGLSMTEGRVDTWLKQEGDEISKGDEVLDVETDKISSSVEAPFSGVLRR
QVAKPDETLPVGALLAVVVEGEAEESEIDAVVQRFQAEFVAEGGADQSQGPAPQKAEVGG
RLLRWFELGEGGTPLVLVHGFGGDLNNWLFNHPALAAERRVIALDLPGHGESAKALQRGD
LDELSETVLALLDHLDIAKAHLAGHSMGGAVSLNVARLAPQRVASLSLVASAGLGEAING
QYLQGFVTAANRNALKPQMVQLFADPALVTRQMLEDMLKFKRLEGVDQALQQLARALADG
DRQRHDLRGVLGNHPALVVWGGKDAIIPASHAEGLEAEVLVLPEAGHMVQMEAAEQVNQQ
LLAFLRKH

BLAST