GenomeNet

>ppf:Pput_1846 RuBisCO-like protein; K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] (A)
MVDHKAGREEFTARFFVESSYPIERVSEVIAGEQSSGTFLSLPGESAELKERSRARVVAI
EPLPSVSSPSLHSDYLARHNPSETYHRGEVTIAFPTANIGTNIPALLTTIAGNLFEIGEV
SGLRVLDLELPERFASGFIGPQFGIEGTRALAGVHDRPIIGTIVKPSIGLTPEQTASVVD
ELCAGGIDFIKDDELLIDPTYASFDARLGAVMPVLHKHADRLGRMPMYAINISGSIDEMM
RRQDAVLEAGGTCVMLCLNWVGHSAVEHIRKHAQLPIHGHRNGWGALTRYPQLGFSFEVY
QKIWRLAGIDHLHVNGIQGKFYEADDSVISSAKSCLAPFAGMRPLMPVFSSGQWAGQAPE
LFNRLQSVDLMHLAGGGIIGHPMGIEAGVQSMREGWEAAVQHVPLERYAEGRPALSAALQ
KFGGN

BLAST