GenomeNet

>ppf:Pput_3181 Glutathione S-transferase, N-terminal domain protein; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MLRILGRASSINVRKVLWACAEFEIAFEREDWGSGFKATDSTEFLALNPNAMVPVIQDGD
FTLWESNSIIRYLASRYGATAFYPGEAQARARIDQWIDWQASDLNRSWSYAFMSLVRHSP
AHQDPQALAAGCAEWSRYMRILDRQLASTGAYVAGSQFTLADIPIGLSVNRWFETPFEHP
HLPAVRDYYERLSERPAYHLHGRNGTP

BLAST