GenomeNet

>ppf:Pput_4377 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) Glutathione S-transferase, N-terminal domain protein (A)
MSYHLIIGDKLYSSWSLRGALALELAGVPYEETLIKLNQPDTRQRILAFSSTGKVPLLKS
EHGVIADSLAIAEYLNERHPEAQLWPADVAARAQARSACAQMHSGFLALRGAMPFDLSRD
QALDSVPLDVQIDIDRIVALWSECRLVAKDSGPFLFGKASLADAFFAPVAVRLRTYRVEV
PAEAAAYIETIYQWPAFQAWQQAGLEEREA

BLAST