GenomeNet

>ppl:POSPLDRAFT_88528 K14154 thiamine-phosphate diphosphorylase / hydroxyethylthiazole kinase [EC:2.5.1.3 2.7.1.50] | (RefSeq) hypothetical protein (A)
MAESKREIDYSVYLVTGRDLLPPGKDYLESLEESLRGGVTIVQIREKTTETGEFLEVARR
SQALCRKFNVPILINDRLDIALAIGADGVHIGQTDMPIAVAKALLPPGAIIGMTCNTPAH
VAQAVKDGADYVGVGPVFATQTKNVASPMLGVRGLQDILAPLEGTNVKAVAIAGIKYTNA
LQCLYGAVRPSGLGLDGLAIVSDIVASHEPEAAARKLATVVHAFKSTIPHIFSLSQHPYS
SQYIKENAAQLFPAIRRHGPLVQQITNTVVTTQSANATLALGASPIMANAPQEMADISKA
IGGLLINFGTIQSLDGMIEAGKHANINRKPVVFDPVGVGASQYRRSSANSLLNTWQATVI
KGNAGELAAIANSQEVRAKGVDSVGQGFKNPALFVRDLARRERCIVVLSGKTDYVSDGTT
VVSLNNGHPLLGDITGSGCMLGTCIAIFCAAASMEATPEDSKLVSGDMFVAAIGGVLALT
LASEKAAARDDVKGSGTFLPALIDELGKLSPEEVVALANVEVVSV

BLAST