GenomeNet

>ppl:POSPLDRAFT_89437 hypothetical protein; K00823 4-aminobutyrate aminotransferase [EC:2.6.1.19] (A)
MSTGSAPVTPLAQFGQQHVTNGLGRQLEAVVLRGEGSYMTLEDGRQMLDFTCGIGVTNLG
HCHPRVSAAAAEQCMKVVHMQCSIAFHEPYLELIKRLLPLMSDPSLDSFFFWNSGGEAIE
AALKIARAATGRQNIISMQGGYHGRTYGAMAVTKSKTGYSEGFHPLMPSVYSLPYPFWHQ
LGMPASTPSSEISAACLSQLSLLLSQQTVPRDTAVILIEPVLGEGGYVPAPPEFLRGLRE
VCDREGILLIIDEVQCGYGRAGKQFAIEYSGVRPDIMTIAKGLANGFPLSGVISRKEIMD
KLKPGSLGGTYAGNAVSCAAACAVADVFKEEHILDNVNACDPTCSPHILDMRGQGLMAAI
EFASPTGTGPYDRFRCADTPKDLACRVAKRCQEKGMLILTTSVYEVIRFIPALNISQEDL
ALGCRIFKEAMEEVVWEG

BLAST