GenomeNet

>ppl:POSPLDRAFT_89758 hypothetical protein; K11422 histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43] (A)
MVIEYVGEIIRAQVADKREKAYERQGIGSSYLFRIDEDLVVDATKKGNLGRLINHSCDPN
CTAKIITINGEKKIVIYAKQDIELGSEITYDYHFPIEQDKIPCLCGSAKCRGFLN

BLAST