GenomeNet

>ppl:POSPLDRAFT_94935 hypothetical protein; K11429 histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43] (A)
MRDLSRDDDFLSHLLVEKLGTGAAPLVVHKMDAGRTIPKANPDSLMQIVRTLVTAKGPPQ
AAIRVAVDELLTHASRYFELYLPTGSIEIAHTSRYSHKTGKSELCILATRPLNTGTVITE
LKGSMADLTDEEDMELKRIDATCVDGVQIRRDFSVIHSKQLKKNHLFLGPARFVNHDCDH
NVELFREGRYITFRVIKPIGVGEEVTAHYGDGYFGRDNRHCLCETCEKLGRGGYATDAED
DEASDSGPGSPLQPRGRRAAPSVDSDSDSEEEEAVVVNVNARSTRRGVYAVVKDKERIKG
KGKEKAAASELVEGAEIELEAEVEQDISSDLTSLPPSRSSAPVPPSKGNGLMTPEPDPQL
QEWLRGVGAEGASVPSTPTKGGMRGASTSTSVLSTPTSFRSVIATRAQKAKKAATAEDDV
AEDEFPDASASVSVSVSARGSGRGRGRRGRGRGFRGRGRGGRSRADMDQPRQLETPPLTA
ESASVSVATSIRSSSRIRSRGGDVTNLSRLTTPVPVSSSLSRAVEPTGRKDKGKERASEE
SESESVSEDGEDEPEPEPEMRTLRPRASLHGHLLAAHGLEHPVMERAEAPRGEDGKLLPT
CITCRNVLPVIHVEGKPVWGLVLGRTGKRGRPKKNIEAECPRCLRHSEIYGLKWPERRPG
DRSSAFLPTPRETRNSTPITHSALAALDRKLAFAKHGYAMPKRPYKRRREVEETEDGPPA
KRAKPIDKPAATSTGRPRGRPPKHRVGMSTKAKQLLKVDTLKVIPKASPVKAKAAPVAKA
SASTNSGRRSGRTRVPSIKLRESVPPRLRSQSRAGHSASRPPTSSSTSASGSSSSLSGPE
TESVVGSLMEPPSTPVKRKREGEGEEDSPKVMTPKSLAVAAQPRESNGRFGKKSHTNGRF
KRNNSALSGAGRRSRQQRALMRLRRLTKKNISTPRCDNEIHPGSEGSSSDLVTSGTSDEA
SSLSRKRPIEDEREDEDMAELSAKRIRIGEDLEDLDLDAVSDGDQDEEEDDAMGDSEPEY
MFRPALFSSRGNSGAGLLCAPNPMSFARRKWSVTPIISQNSVDGGQSSTDDNDTDLPPTP
EDDQDAPVVNAEELAEQLECAEDEDGDSEHTMSVSYSRPILSAPALGGKLLKPSPHNLAR
RRWAPPPPPKVQEERANGLLNRFGDLEYPYTSDEEDNDIRGPAEGLLELARSPKSPILAA
RSSRASTISDLSAPAALLELSRTPKPTGPSSNSRGISLGSTGSTGSSELVVEQLVSMSPS
PRPASLGSPWSGSPRSIGGTPTIQQSPSLPWKQISIREADIPYLKDRSRSFSANLHSSPV
TFERARWCDPSSESDSS

BLAST