GenomeNet

>ppl:POSPLDRAFT_95562 hypothetical protein; K02358 elongation factor Tu (A)
MFHKELDRGEAGDNMGALLRGVKREQIRRGQVIAAPGSIKAVKKFQAQIYVLTKDEGGRY
TPFMDNYRPQLFVRTADVTCGLHWPEGTADAAEKMVMPGDNVEMVCDLMHDVAAEIGTRF
TLREGGKTVGTGIVTEILTFA

BLAST