GenomeNet

>ppl:POSPLDRAFT_95562 K02358 elongation factor Tu | (RefSeq) hypothetical protein (A)
MFHKELDRGEAGDNMGALLRGVKREQIRRGQVIAAPGSIKAVKKFQAQIYVLTKDEGGRY
TPFMDNYRPQLFVRTADVTCGLHWPEGTADAAEKMVMPGDNVEMVCDLMHDVAAEIGTRF
TLREGGKTVGTGIVTEILTFA

BLAST