GenomeNet

>ppm:PPSC2_c3163 transglutaminase; K00686 protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13] (A)
MQRLQFEMILRSRIVESAQALHQSGVSFATFATARCNPQFWELTEKGGFRIKAGVTPAQG
IKDIFINGQQYAFECATAMVIVLYKGVLDSILESEFNQIFADMLLYDWHYDSDLRLIQQQ
GSHKAVPGDILYFNNPDVSSDALEWKGENVIKLKEDSFYGHGIGILPAQGIIDSLNRHRR
PDATVSAYMTNEVIYPDFVYLSQFAPEENRKNELSVNTFYYQEFSHCIHAVIGGRQYIQE

BLAST