GenomeNet

>ppm:PPSC2_p0037 Thymidine kinase; K00857 thymidine kinase [EC:2.7.1.21] (A)
MCENNLGKISVITGPMFSEKSGELIKRILKMERYGGKKVKAYKPTEDFRFEADWIVSRMG
YRYPASNIPRKLTDSIIEEILVETESIDVVAFDEVQFFSKPIMGLVDELAYRGKHVICDG
LNMDYREKEFGFMGGLLTMADEITNLTSYCSVCQSPHARFTQRMVNGMPAKMGPIILIGD
KEDYEVRCRSCYIPPHKVRN

BLAST