GenomeNet

>ppp:PHYPADRAFT_106210 hypothetical protein; K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] (A)
MASVVAASSVVAPATFVAASSSVSNSKSNSVKAFSGLKSATLFTSKAETLSSVQNGSRVQ
CMQVWNPIGQTKFETFSYLPPLSDDAIAKQVEYMIQQKLIPCLEFDVNSNGVSRANNSSP
GYYDGRYWTMWKLPMFGCQDSAQVLREIEECKKTFPGCFVRVLGFDNVKQVQICGFLVAR
PN

BLAST