GenomeNet

>ppp:PHYPADRAFT_123666 K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] | (RefSeq) hypothetical protein (A)
MASIVAASTVVAPAAFAAASSGVSTSESTSVKAFSGLKSATLFSSQSQQLSSVQNGSRVN
CMQVWNPIGMTKFETFSYLPPLSDDAIAKQVEYMIQQKLIPCLEFDNSKGVTRENNSSPG
YYDGRYWTMWKLPMFGCQDSAQVLREIEECKKTFPGCFVRVLGFDNVKQVQICGFLVARP
N

BLAST