GenomeNet

>ppp:PHYPADRAFT_127975 hypothetical protein; K01580 glutamate decarboxylase [EC:4.1.1.15] (A)
MKETRGHNTIDSMFASRYVQCELPKFTIPERATPKDAAYQIISDELMLDGNPRLNLASFV
TTWMEPECDKLIMSALNKNYIDMDEYPITTELQDRCVNMVARLFNAPIEEGEQAIGAGTV
GSSEAIMLAGLAFKRKWQNERKAAGKPWDKPNLVTGANVQVCWEKFARYFEVELREVKLK
EDYYVMDPYKAVELVDENTICVCAILGSTYNGEFEDVQLLNDLLEEKNREKGLHVPIHVD
AASGGFIAPFLYPDIVWDFRLPLVKSINVSGHKYGLVYAGIGWVVWRSKEDLPEELVFHV
NYLGADQPTFTLNFSKGASQVIAQYYQLIRLGFEGYKNIMANCAMNAKILTKAIESTGRF
KILSKEVGVPVVAFSLLDNSDHNEYEISHQLRHYGWTVPAYTMAADAQHVTLLRVVVRED
FSRSLSDRLLTDIKRVLAYFDARPSKLIEAVTAAVVEENKEQHLEMPTTPDAVKATQAFN
TVILEHVACKKKHNGHHHSRSRGGHGKKHASPKANGVC

BLAST