GenomeNet

>ppp:PHYPADRAFT_136703 K00850 6-phosphofructokinase 1 [EC:2.7.1.11] | (RefSeq) hypothetical protein (A)
MGLNLNGTKVYTGAGGAILEDVPHLTDWLSGLPTYPNPLKYNPAYSAARQYFVEETDTVA
KDVVVNINDVGHGIHFRRAGPRDQIYFKPEEVRACIVTCGGLCPGINTVIREIVCGLWTQ
YGVREILGIDGGYRGFYSKNTIDLTPKTVNDIHKRGGTVLQTSRGGHDLGKIVDSIQDRD
INQVYIIGGDGTQKGANAIYEECKRRGLKVAVAGIPKTIDNDIDVIDKSFGFDTAVEEAQ
RAINAAHVEAESVQNGLGLVKLMGRYSGYIAMHATLASRDVDCCLIPEVPFYLHGSGGLI
EFVRKRLRESGHMVIVVAEGAGQELMAESTVNNNDLKDASGNKLLLDVGLWLCTILKDHF
QAEFRETLNLKYIDPKYMIRAIPSNASDNVYCTLLAHGAIHGAMAGYSGFTVGPINNRHC
YIPIKRVVAKSRNVNVADRMWARLMSSTNQPNFSRYEEVVQRQRKLNAQKQEEVENEKST
LSSNGASKPVSLQNVGRQS

BLAST