GenomeNet

>ppp:PHYPADRAFT_138602 hypothetical protein; K01176 alpha-amylase [EC:3.2.1.1] (A)
VFSQGFDWESHNHNPSWWIHFQSKIEDLFELGITDVWLPPASQSVDKHGYLPGQLYNLDS
SRYGKGIELRNLLDVLHMHGMCGIADIVINHRTAGTQDKQGHWNIFDGGVPDKRLAWGAW
AVVDNDVYNSGGKGKHDTGESYGAAPDLDHTSKRVQDELTDWMNWLRAEVGFDGWRFDFA
KGYGPQYCGLYCERTCPSFAVGEIWTSMSYKDSSLLADQDAHRQKLCDWIDGTGGRVCAF
DFTTKGILQTAVEGQLWRLQDSFGKPPGLIGWWPQKAVTFVDNHDTGSTQRHWSFPDDKI
AMGYAYILTHPGIPCIFYDHYFNTHLKFQIKELVQVRLRNHINTESKVSIKIAEADIYVA
SIADRVLVKLGPRQVPISLS

BLAST