GenomeNet

>ppp:PHYPADRAFT_187038 SDG1501; polycomb group protein; K11430 histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43] (A)
MASSSYAIKEEDHEDYEEEEDDEDAAGETVAIALQGFMEQVQCERQAYVKRRMNSNKERL
KGYTWNLLKLDQERKSVWERREVSSFSSLCQKKHQAYGNLNGSDSSGEKDGRLATQESGG
LDKPISIIFGCQTGGKTAIRPVKLRKVENVPPYTTWIYLDRNQRMTEDQSVVGRRRIYYD
SDGNETLIASDSEEEDPGDDDDKDEPKHDFSKGEDTLIWMSIQELGLKSVVLNELSDVLD
IKPEEIEARYDILLKDFAKNAVKEENELPDTQEDDDNETKDLLAAMDSFDTLFCRRCLVF
DCRLHGCSQAIVHPSERQQPWSGTEEDPSPCSKDCYLLVRDVDAGLRDVSQSPEQGQTAT
NGQEDDVGVSERFSKRSGMSSRERSSSSETQAWAAPTILDPGATQPVGRTGSWSKVGSKE
KKSEKRPSATRRSLRVKKARQGVLPSKRKKDVEKDGEVEKDDDMEKDDDVDKDEDRDKDD
DMDKDDLEKDDDLEKDDDTSREGEADEKIAVASAPEGFAFKEGQDEAPGQAVKVEVGVGW
TEMEKGLYEKGLQIFGRNSCLVSRNLLQGCKTCAEVAKYAMELDAAGLGGVRRIADSLAA
SRARLYGVRRKKNMRKLKYTFKSVVHPLIRKRLANGKDQTCRQYTPCNCLYTCGKQCPCL
LNGTCCEKYCGCSKSCKNRFRGCHCAKSNCCSRQCPCFAAGRECDPDVCRNCWVGCGEKH
VKPAVEYTCHNMKLMLKQQQRVLLGRSDVAGWGAFLKKTVAKHEYLGEYTGELISHREAD
KRGKIYDRENSSFLFNLNDQASLYVLDACRKGDKLKFANHSPTPNCYAKVIMVSGDHRVG
IFAKERIGAGEELFYDYQYEPDRAPVWARKPDDPNNKRDDMPSTGGRAQKVA

BLAST