GenomeNet

>ppp:PHYPADRAFT_222395 K01177 beta-amylase [EC:3.2.1.2] | (RefSeq) hypothetical protein (A)
MDTMFPEHKSLLDWDNTADEWKEHAFHETPTSRGVHGGVPVFVMLPLDSVNINNTLKRRR
ALNASLLALKSAGVEGVMMDVWWGIVEKEGPRNYNWSAYRELIDMVRKHGLKVQAVMSFH
QCGGNVGDSCNIPLPPWVLEEVQKNPDLAYTDKAGKRNAEYISLGADNVPALKGRTPVQC
YADFMRSFRDNFKDLLGDVIIEIQCGMGPAGELRYPSYPESEGRWRFPGIGEFQCYDKYM
LASLKANAQALGKPAWGHGGPCDAGNYNQWPDETGFFHRDGSWCSEYGQFFMEWYSEMIL
AHGERLLASASGIFKGTGAVISGKVAGIHWHYGTRSHAAELTAGYYNTRTRDGYATIAQM
FAKYGVTLNFTCIEMRDYEQPSQASCSPEGLVRQVALATRRAGIPMAGENALPRFDSSAH
EQIVRKSRLRMNEHGDCHEEYEPMAAFTFLRMCESLFHSENWKLFVPFVRHMEEGRTFQP
WEEEHHRTETHVHATRPLVQEAASLMY

BLAST