GenomeNet

>ppp:PHYPADRAFT_228858 K00844 hexokinase [EC:2.7.1.1] | (RefSeq) hxk3; hexokinase protein HXK3 (A)
MGQSKVLVGVYIACAAAACATAAVAVTQRLKVRAQKCTARKILVEFQEACETPLPRLRQV
VDAMAVEMHAGLVSEGGSKLKMLPTFIDRLPNGSEKGLYYAVDLGGTNFRVLRVQLGGLE
GRVIKQEYEEVAIPPELMLGTSEQLFHFIAKELAGFVAREGEEFRLGDGQSREIGFTFSF
PCKQTAVNSGTLLQWTKGFKVNDAIGQDVVAALQKCIERLGCKMRIAALVNDTVGTLAGG
RYWNNDVMIAVILGTGTNACYVERAESISKWTGELPKSGQMVINMEWGNFWSSHLPRTYV
DELLDSESLHPGEYGFEKMISGMYLGDCVRRVLVRMAQEAGIFGPHVPHTLLESFSLQTP
EMSRMHHDDSSDLKVVAEVLKRLYGIQNTTVGIRKIVVAVCDTTCQRGARLAAAGIVGIL
KKIGRDGSTANGLMRRNDTNGIHDELSVNSTPGSGKTVVAMDGGLYEHYSKFRNYMQEAV
RELLGDASKNVSIELSKDGSGIGAALLAASYAEYVPS

BLAST