GenomeNet

>ppp:PHYPADRAFT_228858 hxk3; hexokinase protein HXK3; K00844 hexokinase [EC:2.7.1.1] (A)
MGQSKVLVGVYIACAAAACATAAVAVTQRLKVRAQKCTARKILVEFQEACETPLPRLRQV
VDAMAVEMHAGLVSEGGSKLKMLPTFIDRLPNGSEKGLYYAVDLGGTNFRVLRVQLGGLE
GRVIKQEYEEVAIPPELMLGTSEQLFHFIAKELAGFVAREGEEFRLGDGQSREIGFTFSF
PCKQTAVNSGTLLQWTKGFKVNDAIGQDVVAALQKCIERLGCKMRIAALVNDTVGTLAGG
RYWNNDVMIAVILGTGTNACYVERAESISKWTGELPKSGQMVINMEWGNFWSSHLPRTYV
DELLDSESLHPGEYGFEKMISGMYLGDCVRRVLVRMAQEAGIFGPHVPHTLLESFSLQTP
EMSRMHHDDSSDLKVVAEVLKRLYGIQNTTVGIRKIVVAVCDTTCQRGARLAAAGIVGIL
KKIGRDGSTANGLMRRNDTNGIHDELSVNSTPGSGKTVVAMDGGLYEHYSKFRNYMQEAV
RELLGDASKNVSIELSKDGSGIGAALLAASYAEYVPS

BLAST