GenomeNet

>ppp:PHYPADRAFT_228859 hxk4; hexokinase protein HXK4; K00844 hexokinase [EC:2.7.1.1] (A)
MENLKNSESCDPSSFLRHFRKSSATPVMLLRHIAQAMATEMQEGLDHPGERKLKMLPTYL
ECLPTGNERGLFYAIDLGGTNFRVLRVQLDGKEGRILKQESIQVPIPQEVMTGSSKDLFG
FLAKTIVQFVSREADLGFECVALNQKRDIGFTFSFPVNQTKVNGGSINAWTKGFSISDGV
GEDVVDQLEIALADMGSVNTKVVCLVNDTVGTLAQCRYWNDDAMVGVILGTGSNACYVER
AAAISCWSSPPEADDLTVVNIEWGNFCSELLPRTFADEGLDADSLNPGQQEFEKMIGGMY
LGEILRRVLLKMAEDTGLFGSEIPERLTKPFSLLTPHMSTMHGDDTSSLEVVGSVIEEAI
GVKYTTLATRKVVYDVCDIIAERGARLSAAGIVGILTKINRCGDLMLSCLTTPNDTEVKK
TVIAIDGSLYEKYPKFRNYMEDAMKEMLGEDYANNVTTTLSKDGSGVGAALLAAAISTEL
RLGDVGVTK

BLAST