GenomeNet

>ppp:PHYPADRAFT_228860 hxk5; hexokinase protein HXK5; K00844 hexokinase [EC:2.7.1.1] (A)
MSMTVERVSLFSRGAGVTMHGLLSARVQCVRSPWWGLPKVAGATPNANRVVRVHNADRLV
HGLRLAAATPLPLLRQVADALVGEMCAGLEEEGGSDQLKMLPSYVENLPTGDEEGLFYAV
DLGGTNFRVLRLHLGGKGQVLSQESKEIAIPRELMVGTGKDLFDFIANTLATFVDTEDIL
LDSKSNKHREAGFAFSFPVRQTSVKSGNVIQWTKGFKIDDAIGKDIVKQFQDAISRSGHD
VEISALVNDTVGTLAGGRYNFQEETMIGCILGTGTNACYVERADAVKKWKEALPKSGEMV
INLEWGNFRSPWLPRTFADDEVDKESVNPGDQWFEKMVSGMYLGEIVRHMLLRLAEEATL
FGDTVPEKLREQQSLETKHVSKIHADISSELQTVATVLHEVLRIHDTTLEQRRIVHSLCD
MVGQRGGRLAAAGLYGILKKIGRAGPNKNGFALSRQKKTTVVAMDGGLYEHHHPYRKYME
DALQELVGTNGPYEVFLRLQNDGSGIGAALLAASHSRHRQTE

BLAST