GenomeNet

>ppp:PHYPADRAFT_228860 K00844 hexokinase [EC:2.7.1.1] | (RefSeq) hxk5; hexokinase protein HXK5 (A)
MSMTVERVSLFSRGAGVTMHGLLSARVQCVRSPWWGLPKVAGATPNANRVVRVHNADRLV
HGLRLAAATPLPLLRQVADALVGEMCAGLEEEGGSDQLKMLPSYVENLPTGDEEGLFYAV
DLGGTNFRVLRLHLGGKGQVLSQESKEIAIPRELMVGTGKDLFDFIANTLATFVDTEDIL
LDSKSNKHREAGFAFSFPVRQTSVKSGNVIQWTKGFKIDDAIGKDIVKQFQDAISRSGHD
VEISALVNDTVGTLAGGRYNFQEETMIGCILGTGTNACYVERADAVKKWKEALPKSGEMV
INLEWGNFRSPWLPRTFADDEVDKESVNPGDQWFEKMVSGMYLGEIVRHMLLRLAEEATL
FGDTVPEKLREQQSLETKHVSKIHADISSELQTVATVLHEVLRIHDTTLEQRRIVHSLCD
MVGQRGGRLAAAGLYGILKKIGRAGPNKNGFALSRQKKTTVVAMDGGLYEHHHPYRKYME
DALQELVGTNGPYEVFLRLQNDGSGIGAALLAASHSRHRQTE

BLAST