GenomeNet

>ppp:PHYPADRAFT_235449 hxk8; hexokinase protein HXK8; K00844 hexokinase [EC:2.7.1.1] (A)
MGQSKAMAGVYIACAAAACAAAAVVLTQRVKVRSQKYTARKILVEFQEACETPLPRLRQV
VDAMAVEMHAGLVSEGGSKLKMLPTFIDHLPDGNEKGLYYAVDLGGTNFRVLRTQLGGLE
GRVIKQEYEEVAIPPELMLGTSEQLFDFIAKELVSFVAREGEDFRLHEGQSREIGFTFSF
PCKQTAVNSGTLLQWTKGFKVNDAIGQDVVAALQGSIERRGYKMRIAALVNDTVGTLAGG
RYWNNDVMIAVILGTGTNACYVERAESISKWGGELPKSGQMVINMEWGNFWSSHLPRTYV
DELLDNESLNPGEYGFEKMISGMYLGDCVRRVLVRMAQQAGIFGPHVPHKLLEAFTLQTP
DMSKMHHDDSSDLKMVAEVLKTVYGIHNTTLGIRKIVLAVCDIVCQRGARLAAAGIVGIL
KKIGRDGSTANGFIRRNDVNGIHDELTVNSIGGSGKTVVAMDGGLYEHYSKFRNYMQQAV
RELLGDAAKNVFIELSKDGSGIGAAILAASHAEYVPT

BLAST