GenomeNet

>ppp:PHYPADRAFT_235449 K00844 hexokinase [EC:2.7.1.1] | (RefSeq) hxk8; hexokinase protein HXK8 (A)
MGQSKAMAGVYIACAAAACAAAAVVLTQRVKVRSQKYTARKILVEFQEACETPLPRLRQV
VDAMAVEMHAGLVSEGGSKLKMLPTFIDHLPDGNEKGLYYAVDLGGTNFRVLRTQLGGLE
GRVIKQEYEEVAIPPELMLGTSEQLFDFIAKELVSFVAREGEDFRLHEGQSREIGFTFSF
PCKQTAVNSGTLLQWTKGFKVNDAIGQDVVAALQGSIERRGYKMRIAALVNDTVGTLAGG
RYWNNDVMIAVILGTGTNACYVERAESISKWGGELPKSGQMVINMEWGNFWSSHLPRTYV
DELLDNESLNPGEYGFEKMISGMYLGDCVRRVLVRMAQQAGIFGPHVPHKLLEAFTLQTP
DMSKMHHDDSSDLKMVAEVLKTVYGIHNTTLGIRKIVLAVCDIVCQRGARLAAAGIVGIL
KKIGRDGSTANGFIRRNDVNGIHDELTVNSIGGSGKTVVAMDGGLYEHYSKFRNYMQQAV
RELLGDAAKNVFIELSKDGSGIGAAILAASHAEYVPT

BLAST