GenomeNet

>ppp:PHYPADRAFT_76959 K01895 acetyl-CoA synthetase [EC:6.2.1.1] | (RefSeq) hypothetical protein (A)
MYKRSVEDPDGFWGDIASTFFWKKKWPTTEGKLYSENIDVRTGRVAVEWFKGGQTNICYN
ALDRHVEAGFGDKVAFFWEGNDTGVDATLTYKEVLERVCQLANYLRSQGVKKGDAVAIYM
PMLAELPIAMLACARIGAVHSVVFAGFSAESLSQRILDCKPNIILTSSAVKRAAKVIKLK
DIVDDALKTAAENGHSVGLCLTYDNNSALKREDTAWQEGRDVWWQDVVPSHSKECEVEWV
DAEDTLFLLYTSGSTGKPKGVLHTTGGYMVYAATTFKYAFNYHEDDVYWCTADCGWITGH
SYLTYGPLLNGASMVVFEGVPNYPDAGRCWEIVDKYNVTIFYTAPTAIRSLMRSGDEPVK
RHSRKSLRVLGSVGEPINPSAWKWYYEVVGDKRCPIVDTWWQTETGGFMITPLPGAWCLK
PGSATLPFFGIQPAVVDENGHAQTGECSGYLCIKAAWPGMMRTLQGDHDRYETTYFAPFK
GYYFSGDGCRRDKDGFYWLTGRVDDVINVSGHRIGTAEVESALVSHPQCAEAAVVGFDHE
VKGQGIFAFVTLLEFVEYSDELRTALVNAVRSQIGAFAAPDVIHWAPGLPKTRSGKIMRR
ILRKIASNQLDELGDISTLADTSVVDQLISLRGK

BLAST