GenomeNet

>ppr:PBPRA1084 STY1301; putative thymidine kinase; K00857 thymidine kinase [EC:2.7.1.21] (A)
MAQMYFYYSAMNAGKSTTLLQSSFNYRERGMRPVIFTAAIDDRFGTGKVSSRIGLEEDAE
LYNKSDDLWSKLSMMHADTHIDCVLIDECQFLTKEQVYQLTEVVDKLHIPVLCYGLRSDF
RGELFDGSRYLLSWADKLVELKTICHCGRKANMVIRQDEAGHAIADGDQVEIGGNDRYVS
VCRKHYKEALGR

BLAST