GenomeNet

>ppr:PBPRA1084 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) STY1301; putative thymidine kinase (A)
MAQMYFYYSAMNAGKSTTLLQSSFNYRERGMRPVIFTAAIDDRFGTGKVSSRIGLEEDAE
LYNKSDDLWSKLSMMHADTHIDCVLIDECQFLTKEQVYQLTEVVDKLHIPVLCYGLRSDF
RGELFDGSRYLLSWADKLVELKTICHCGRKANMVIRQDEAGHAIADGDQVEIGGNDRYVS
VCRKHYKEALGR

BLAST