GenomeNet

>ppr:PBPRA1372 K00111 glycerol-3-phosphate dehydrogenase [EC:1.1.5.3] | (GenBank) Y0404; Putative anaerobic glycerol-3-phosphate dehydrogenase, subunit A (A)
MTSWLETDVVIIGGGATGTGIMRDCALRGIKCILVERDDLASGTTGRNHGLLHSGARYAV
TDEESARECIQENRILKNIARHCVEDTQGLFISLPDDDLDFQKSFLTACGRADIDVEQLS
PEEALRLEPNCNPNLIGAVKVPDGTIDPFRLASSNVLDAVEHGARLFNHTHVTGLIREGH
AVRGVRCLNMKTGEHFDIRSKQVINAAGIWGQQICEYGDLNIKMFPAKGSLLILDYRINN
LVINRCRKPSDADILVPGDTISLIGTTSERIDYDKIDDLHVTSREIDVLLEEGAKLAPIM
ANTRVLRAYAGVRPLVAVDGDTSGRNISRGIVLLDHAERDGMDGFITITGGKLMTYRMMA
EWATDLVAKKLGNTQPCITHTKPLPGSEQAQKKVKHTASLAKPIYQSAYYRHGERAEKFL
KNDKKSQAVICECEMVTSGEVEYAIKELDVHNLVDLRRRTRVGMGPCQGELCSYRAAGLF
SEYGQSSGTEASHLLSDFLEERWKGIKPVFWGDALREAEFTYWIYEGLFGVSDIPDSDLP
SLPTLNLDTDNSTATQTNENKSEVAS

BLAST