GenomeNet

>ppuu:PputUW4_00393 K01113 alkaline phosphatase D [EC:3.1.3.1] | (GenBank) phoD1; phosphodiesterase/alkaline phosphatase D-like protein (A)
MDSSMLKPTVGPIIGHTTTNHARILVRGQAQNSAPVFAGIRYRQSGHEQWLNSVFARLTY
LQDMSDVIVLNNLAADTEYEYQAGWFSTQSTEHTADSLQELPLQWPPELYRLRTRSGAAG
TPQAYFVGSCRYLRMTAGIPSAPQQGDRIFASMAQLAEQADPPVSAVLMTGDQIYADDLN
FFAPDREYQQILAKYHAAFSQPHISRLMANVSTYMILDDHEIKDNWPDKKSSTDEALYKN
AITAYELYQASHSPAFELLDDGRISRIPNHYWYQFADGDIEWFVTDSRTRRNLSADDRRM
LDLEQEHALCQWLINSPARVKLVITSVMFFPDAKHDGNDAWAGFPGQRLRLLEFIRSHRL
KNVIFVSGDIHASLTSRLTHSEDPDFEMHTIVSSPLCNTKLLPYASQSSFILDRPLARNT
AGEYRQELTGMVISQDNFAHLIIDAERIQVNYHDRDGKLLQSTDINLR

BLAST