GenomeNet

>ppuu:PputUW4_00393 phoD1; phosphodiesterase/alkaline phosphatase D-like protein (EC:3.1.3.1); K01113 alkaline phosphatase D [EC:3.1.3.1] (A)
MDSSMLKPTVGPIIGHTTTNHARILVRGQAQNSAPVFAGIRYRQSGHEQWLNSVFARLTY
LQDMSDVIVLNNLAADTEYEYQAGWFSTQSTEHTADSLQELPLQWPPELYRLRTRSGAAG
TPQAYFVGSCRYLRMTAGIPSAPQQGDRIFASMAQLAEQADPPVSAVLMTGDQIYADDLN
FFAPDREYQQILAKYHAAFSQPHISRLMANVSTYMILDDHEIKDNWPDKKSSTDEALYKN
AITAYELYQASHSPAFELLDDGRISRIPNHYWYQFADGDIEWFVTDSRTRRNLSADDRRM
LDLEQEHALCQWLINSPARVKLVITSVMFFPDAKHDGNDAWAGFPGQRLRLLEFIRSHRL
KNVIFVSGDIHASLTSRLTHSEDPDFEMHTIVSSPLCNTKLLPYASQSSFILDRPLARNT
AGEYRQELTGMVISQDNFAHLIIDAERIQVNYHDRDGKLLQSTDINLR

BLAST