GenomeNet

>ppw:PputW619_1429 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) Glutathione S-transferase domain (A)
MYKVYGDYQSGNCYKVKLMLSLLDSPYEWHPVDILKGGTETPEFLAMNPNGKVPVLQLED
GTCLWESNAILNFLADGSEYLPSEPRLRTQVLQWQFFEQYSHEPYIAVARFIQFYLGLPD
ERVDEYRKLHKGGYKALRVMERQLQMTPYLVGEQYSIADVALYAYTHVAHQGGFDLAEYP
GVRAWLDRVAAHPRHVPMVG

BLAST