GenomeNet

>ppy:PPE_02788 K00686 protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13] | (GenBank) transglutaminase (A)
MQRLQFEMILRSRIVESAEALHRSGVSFATFATARCNQQFWDLTEKGGFQIKAGVTPAQG
IRDIFLNGHQYAFECATAMVIVLYKGVLDSILESEFNRIFADMLLYDWHYDSDLRLIQQE
GSHKAAPGDILYFNNPDVSSETLEWKGENVVKLKEDLFYGHGIGILPAKGIIDSLNQHRR
PEATVSAYLTDEVIYPDFIYLSQFAAEGNRKNEISLHTLYQQEYSHHIHAFIGGRQYIRG

BLAST