GenomeNet

>pru:PRU_1868 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) tdk; thymidine kinase (A)
MIENLTGEAHRPGRIEVVCGSMFSGKTEELIRRMRRAQFARQKVEIFKPAIDVRYSEEDV
VSHDQKHIQSTPIDSPGSILLLSSDIDVVGIDEAQFFDMGIVDVCNELANRGVRVIVAGL
DMDYKGVPFGPMPALCAIADDVTKVHAICVKCGNLAYVSHRKVQSEQRVLLGETTEYEPL
CRECYQKAIREENERKDNHA

BLAST