GenomeNet

>psa:PST_2130 DNA ligase, ATP-dependent, putative; K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] (A)
MALEDYQRMRDFAATPEPAGKARPKPRKSQALQYCIQKHDATRLHYDFRLELDGTLKSWA
IPKGPSLDPGVRRLAVHVEDHPLEYATFEGNIPEGHYGAGDVIVWDRGVWTPQGDPQEGY
RKGKLKFSLEGEKLAGSWNLVRTQMDGKKEQWFLIKSRDEAAREESEYDIVTAEPDSVLS
DRTLVPRKRGAKARVAETPPAPVKAPAKKRTPARRKAKVALEGAVPAELPERFKPQLATL
VDTVPVGDWRYEIKFDGYRMLARIDAGEVRLFTRNGHDWTAKMPQQAAALAGLGLESGWL
DGEVVVPNEEGTPDFQALQNAFEAGRSGSILYYLFDMPYLNGMDLREVALEQRRAALREV
LERSDSELLRFSEDFTEQPDSILESACQMKLEGLIGKRAGSTYTSRRSSSWVKIKCSNRQ
EFIIVGYTQPKGTRTGFGALLLGLHDDKGELRYAGKVGTGFNHATLQSLHKKLKKLETDK
SPLAKAPPAADARGAQWLKPELMCEVAYAEMTRQGVVRHSVFHGLRTDKPAEAITHERAK
PVARATPNVAGKADPLGSGRIKISNPERVIDPSSGITKIELARFYAQIAPWALPQLQNRP
LALVRAPEGITGELFFQKHADKLAIPHITQLDPALDPKHGALLVIDSAEALVGAAQMGTI
ELHSWNAVAPDLEHPDRFVLDLDPDPALPWKRMLEATQLTQTLLDEIGLASFLKTSGGKG
LHIVVPLDPVQDWSEVKSFSQAIARHLATLLPSHFSAVSGPKNRVGRIFIDYLRNSRGAS
TVAPYSVRAREGLPVSVPIHRDELADLKGANLWTVRNLLERLQELGDDDPWAAIGKTRQR
LTKKIRDRLNA

BLAST