GenomeNet

>psa:PST_3679 aldehyde dehydrogenase family protein; K00138 aldehyde dehydrogenase [EC:1.2.1.-] (A)
MRYAHPGSEGAVVSFKSRYGNYINGQFVEPAGGQYFTNLSPVNGQPIAEFPRSDAADIEK
ALDAAHAAADAWGKTSVQARSLILLQIADRIEQNLEMLAITETWDNGKAVRETLNADIPL
AADHFRYFAGCIRAQEGTSAEIDEHTAAYHFHEPLGVVGQIIPWNFPILMAAWKLAPALA
AGNCVVLKPAEQTPLGINVLLECIGDLLPPGVLNVVHGYGREAGEALASSKRIAKIAFTG
STPVGSHIMKRAAEHIIPSTVELGGKSPNIYFEDIMQAEPAFIEKAAEGLVLGFFNQGEV
CTCPSRALVQESIYAPFMEAVMKKVAQIKRGDPLDTDTMVGAQASQQQFDKIMSYLKIAQ
EEGAEVLTGGAAEKLEGSLATGYYIQPTLLKGTNKMRVFQEEIFGPVIGVTTFKDEAEAL
AIANDTEYGLGAGVWTRDINRAYRMGRAIKAGRVWTNCYHLYPAHAAFGGYKKSGVGRET
HKMILDSYQQTKNLLVSYDINPLGFF

BLAST