GenomeNet

>psc:A458_09985 alpha-amylase family protein; K05343 maltose alpha-D-glucosyltransferase/ alpha-amylase [EC:5.4.99.16 3.2.1.1] (A)
MAKPRKPAAFIKDPLWYKDAVVYQVHLKSFYDSNNDGVGDFPGLIEKLDYIADLGVNTIW
LLPFYPSPRRDDGYDIADYRGVHPEYGSMADARRFIAEAHKRGLRVITELVINHTSDQHP
WFQRARKAKKGSAARDFYVWSDTDKKYDGTRIIFLDTEKSNWTWDPVAKQYFWHRFYSHQ
PDLNFDNPQVMKAVLAVMRYWLDMGIDGLRLDAIPYLVERDGTNNENLPETHAVLKAIRA
EIDANYPDRMLLAEANQWPEDTQLYFGGEDGGPGDECHMAFHFPLMPRMYMAIAQEDRFP
ITDILRQTPDIPENCQWAIFLRNHDELTLEMVTDKERDYLWNYYASDKRARINLGIRRRL
APLLERDRRRIELLNSLLLSMPGTPVIYYGDEIGMGDNIFLGDRDGVRTPMQWSVDRNGG
FSRADPPNLVLPPVMDPLYGYYTINVEAQQRDPHSLLNWTRRMLTIRKQFKAFGRGTLKM
LAPSNRRILAYMREFTGANGETEIIFCVANVSRSAQAAELEMSQYAGMVPVEMVGGSAFP
PIGQLPYLLTLPHYGFYWFQLALTNQMPSWHQEPVDTMPDFQTLVLKRLDTLTAANRRIL
ETEALPAYLPKRRWFAAKDVAIESVRISYCVPFGDPNRPVLLSELCVESAGRSDLYQLPL
GFLAETEFEVALPQQLALARVRRGPQVGLMTDAFALEQFSAAVIQGLRDELVLPCNDGEI
RFVPMPQLADLQLPAHPEVRFISAEQSNSSAIIDNKVMIKLLRRVAPGVHPELEMGGFLT
ERGFAHISGMLGQVSRINKQGEPVALMVIQHFLDSQGDAWVWTLNNLDRAVRDEIAGGVS
MHENQFSALDELQAFNRLLGQRLGEMHMALATQTEDPAFAYESTSTADTKQWEQSVSAQL
EQALQRLEEHRSSFDRKEATALGQLLARRDKLLEQVQRLAARTVGGVRTRVHGDLHLGQV
LVVQGDAYFIDFEGEPARSLDERRAKHSPFKDVSGLLRSFEYAAAMTIRGAQISDSTPEA
DQARQRIAASYQSSAQAAFFEAYREATAELPHDWRDADGANAALLLFSLEKCAYEIVYEA
ENRPTWLPVPLQGLLALAQQLFDGGSND

BLAST