GenomeNet

>psf:PSE_0360 K01283 peptidyl-dipeptidase A [EC:3.4.15.1] | (GenBank) angiotensin I converting enzyme isoform 2 (A)
MLPALSLALIPLSAAQAEGEKAVTVEDAKAFIESSEKAIQEIGEEAGRIAWVNANFITYD
TNWLNALMSERTTKLYVSLANQTKQFDGLALPPDLARKMKLLKLNLTLPAPENDPAKIKK
LAQINTEMETIYGTGKYEIDGEALSLSKLSRIMATSRDYDKLLEVWKGWRTVSPPMKDMY
AEMVGIANQGSSELGFKDTGSMWRSKYDMDPDDFRQDVDRLWGEVKPLYDSLHCYVRGKL
VDHYGADKVPADGPIPAHLLGNMWAQSWGNIYPLVAAEGDDQGYDLTKLLEEQNYTPLKM
VQTAEGFFTSLGFDPLPETFYERSLITEPRDRDVQCHASAWNVDGKEDLRIKMCTEVTGE
DFNTVHHELGHNFYQRAYNHQSPMYQDDPNDGFHEAIGDMVSLSITPKYLKQIGLLPLDA
SEEVNTNILMAQALDKIAFLPFGLLVDQWRWKVFNGELTPDTYNEGWWELREKYQGVAAP
VERAADAFDPGAKYHIPNNVPYTRYFLAHIFQFQFYREACRIAGWEGPLAACSIYGNKEV
GKKFNAMLETGSALPWQDSLEAFTGSREADATAILEYFAPLKAYLDEQNKGKSCGW

BLAST