GenomeNet

>psf:PSE_0699 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) Glutathione S-transferase family protein (A)
MMNPAGTLPVLKENDGPAVCGATVIMEYLDETRGYAIPNNRLLPDHPEARAETRRLVSWF
LQKFLSEVIGYIVQERIYKQEMPDSQGGGQPDSSILRVARANMLNHMRYIGYLAATRKWL
AGDRLTFADLAAASLLSCADYLGEVPWSEDENVKSWYARMKSRPSFRPILTDKMLGMPAA
KTYADLDF

BLAST