GenomeNet

>psf:PSE_0699 Glutathione S-transferase family protein; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MMNPAGTLPVLKENDGPAVCGATVIMEYLDETRGYAIPNNRLLPDHPEARAETRRLVSWF
LQKFLSEVIGYIVQERIYKQEMPDSQGGGQPDSSILRVARANMLNHMRYIGYLAATRKWL
AGDRLTFADLAAASLLSCADYLGEVPWSEDENVKSWYARMKSRPSFRPILTDKMLGMPAA
KTYADLDF

BLAST