GenomeNet

>psp:PSPPH_4666 K00138 aldehyde dehydrogenase [EC:1.2.1.-] | (GenBank) aldehyde dehydrogenase family protein (A)
MRYAHPGTEGAIVNFKERYGNYIGGEFVAPVKGQYFTNTSPVTGKAIAEFPRSTAEDIEK
ALDAAHAAAAAWGSTSVQARSLVLLKIADRIEANLEVLAITETWDNGKAIRETLNADIPL
AADHFRYFAGVLRAQEGSAAEIDGNTVAYHIHEPLGVVGQIIPWNFPLLMAAWKLAPALA
AGNCIVLKPAEQTPLGISVLIELIGDLLPPGVLNIVQGYGREAGEALASSKRIAKIAFTG
STPVGSHIMKLAADNIIPSTVELGGKSPNIFFEDIMSAEPEFIDKAAEGLVLAFFNQGEV
CTCPSRALVQESIYPQFMEAVMRKVEKIKRGDPLDTDTMVGAQASEQQFDKILSYLDIAK
GEGAELLTGGKVEKLEGSLSTGYYIQPTLLKGNNKMRVFQEEIFGPVVSVTTFKDEAEAV
AIANDTEFGLGAGLWTRDINRAYRVGRAIKAGRVWTNCYHLYPAHAAFGGYKKSGVGRET
HKIALEHYQQTKNLLVSYDTNPLGFF

BLAST