GenomeNet

>psr:PSTAA_0543 K05343 maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1] | (GenBank) putative trehalose synthase protein (A)
MRPLWYRNAVIYQIDPSLFRDSNGDGCGDLRGITERLDYIRGLGCTAIWLMPFYQSPFED
AGYDISDHLQVAERFGDLADIVALLEKAEELGLHVIIELVVQHTSSEHRWFQEARRDRDS
PYRDYYIWADEPDDAIEPIFPTVEDSVWTWDEQAGQYYRHLFYKHEPDLDLTNPRVIHEI
ERIMSFWLRLGVSGFRIDAAVHMVRQAGGGDLRQGYWLLEHMRDFVTMRRPETVLLGEID
TDPEKYIEYFGDEADRVTLLLDFWVNNHLFLALARQQAEPLCRALNSQPLPPSHSQYALW
IRNHDELSLDRLEEDERNEVLDTFAPDQNMRAYNRGIRRRLAPMLDGDERRIAATHALLF
SLPGTPIIRYGEEIGMGDDLERPERLAVRTPMQWSNEPNAGFSCIDAQRLIAPVIDEGPF
AFDRVNVFAQTLRSDSLMARTGNMIRTRIGLREIGIGKRRTVEVDDPSVFAIRHDNDSTV
LMLVNLADRETTVTITDDDLQDMVDVLADCDYGQPEGTPLQLRLGPYGYRWLRRKQQLFG

BLAST