GenomeNet

>pst:PSPTO_4398 glutathione S-transferase family protein; K04097 glutathione S-transferase [EC:2.5.1.18] (A)
MSLHLIIGDKRYSSWSLRPWLVLEMIGAPFTDQVIRLNQPDTRDNILQYSPTGKVPALQC
EHGTIIDSLAICEYLVERFPDADLWPRDIAARAQARSACAQMHSGFVSLRSNMPMDLRRD
QALEVISVDTQNDIDRIVALWAECHAAAVETGPFLFGKPSIADAFFAPVAIRLRGYRVQL
PAEALAYVETLYQWPAFKRWQQVWRSPDRETSSCGRRRHSRYRRPGTDRPTRRQSASGRP
LGVSWRQGRGGRDGRDCACT

BLAST