GenomeNet

>psz:PSTAB_2911 glutathione S-transferase family protein; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MKLYDLEASGNCYKVRLFAALADIELERVPVDLANGAHKKPPLSEMNPLRQVPVLEDDGH
VVRDSQAILVYLAGTYGGLAWWPDHARGQAEIVQWLSFAANEVQHSLSAARLVEKFGYPL
DKEAALAKAPAVLALLDAHLETNDWLAMGRPTIADCAVYPYVVLAPEGSVDLGPYGNVAR
WMTRLESLPGYLPRP

BLAST