GenomeNet

>pta:HPL003_14050 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) eukaryotic-type DNA primase (A)
MGQAIKGIITIEGLEIPITNPDKPLWPEAGVTKAMYLRKLAVLAPFLLKYSHNRLLTVIR
WPHGIHGDFFYQKNTPQPRPDYIETFLHDGIEYMVLGTLAQLLWLGNQAALEFHPSLHPV
GSTLPCEWMIDLDPSREVEPRIMEAASIVGEVLASLGLESVPKTSGATGVQIIVPIRTGI
TFDELRSIGLLVGQFVTEKHPHLFTLERLKKDRGTAIYFDYLQHYKGKTLAAPYTPRARP
GATVSTPLTWDEVRQNVSPLDYHLLNIEERLNQMGDLIAKVPPQPIEDVLKHMRAKTHSS

BLAST