GenomeNet

>pta:HPL003_22170 K01223 6-phospho-beta-glucosidase [EC:3.2.1.86] | (GenBank) glycoside hydrolase family protein (A)
MKHNQLKEFPPTFLWGASTSAYQFEGAWNEDGKGPSVIDTRSPREGISDYTVASNHYHHY
REDIALLAEMGFKAYRFSIAWTRIYPQGTGQLNSQGIRFYNDVINELLRYGIEPIVTMYH
FDLPAALEKQGGWSNRRTIDAFEAYAKTLFENFGDRVKYWLTINEQNMMILHGSALGTLD
PSLQDPKKELYQQNHHMLLAQAKAMILCKKMLPHAKVAPAPNISCVYPASPCPDDVLAAD
NFNAIRNWLYLDMAVYGRYNTLVWSYFEEKGYTPKIAEGDMDILAAAQPDFIAFNYYSSA
TVKSNLRDTEEKGGMGDQQIAVGEAGVYAGSGNEYLERTAFGWRIDPAGLRVTLRTIYDR
YQLPMMITENGLGAHDTLEEDGTVNDHYRIDYLRKHIEQCRLAMTDGVELFGYCPWSAVD
LVSTHQGVSKRYGFVYVDRDEFNLKQLRRIRKNSFYWYKDVISSNGSVL

BLAST