GenomeNet

>pte:PTT_10362 K01580 glutamate decarboxylase [EC:4.1.1.15] | (RefSeq) hypothetical protein (A)
MASESATQSPLNRADEVQDLLTAIQHLIVPFIRAADEDALTKPTGHGLQVSGGGPRTVLV
EHHPPQKLESLLAQELEISNAGTEKQGEDQGKEGLVKLVSSILKYSVNTWDQGFLDKLYA
STNAVGVVSELLLAVLNTNAHVYAVSPVLTLIEKRTTTYLASLFSLPPSTSGGLTLPGGS
ASNSTAITLARNTLYPLTKTEGNASFKFTLFTSEHGHYSIEKAANILGLGTKNVITVPVD
ENGCMIPSALEQKINESRQRGETPLFLNATAGTTVHGSFDPFTALAAICKTENIWFHIDG
SWGGSVVFSPKYRASRLAGAELADSITINPHKMLGTPVTCSFLLARDMNQMHKALTLPAG
YLFHGSTGSVDARDVYDLGDLSPQCGRRADSLKLFLALKYYGPEHFARLVETAYEGAEYL
LSKVKESGNFVAISPEPLPCLQVCFYYAKGGVLREDKELNSRTTTEIAQRLVSRGFMVDF
APGEKGKFFRVVVNGGTLVGTLDGLVKAIEETGEELGF

BLAST