GenomeNet

>pte:PTT_11058 K00823 4-aminobutyrate aminotransferase [EC:2.6.1.19] | (RefSeq) hypothetical protein (A)
MSRGISISSATLRNLVSPAACRVPVRLRPFSSTTTPQQQFANMDAAAFGEQHIARGIGRL
TKHVFEDGKGTWITTDKGVKLLDMTAGIGVLNLGHCHPKVSAAAAAQCGKITHAQVNIGF
SAAQIALLRELIPILPHESLDTVFLWNSGAEAVEAAVKLARAATKKPNIIVMQGSYHGRT
NATASMTRSKTIYGEGHGPLMGGVFATAFPYYSQFGLPATTPTEELVNQSLLQLRLTLSQ
QTSPSDTAAIILEPVLGEGGYVPAPPAFLAGIRQICDENNILLIVDEVQSGMGRTGHLWF
VQESGVRPDILIFAKGVANGFPLSGIASSKNIMDLQKPGSMGGTYAGNAVSCAAATACIK
AFHEEKILENVAKRSEHIFSFLRDLQKSGTKAGSLIEDIRGSGLMVGVQFANPALQSGSS
NAASRHAGDQPQIAPKVVQECVKRNMLILSTSVFDVIRFIPPLNISEEEMTQGLGIFKES
LEAVAKDL

BLAST