GenomeNet

>pte:PTT_13889 K11407 histone deacetylase 6 [EC:3.5.1.98] | (RefSeq) hypothetical protein (A)
MEDEDCTMGDDSIIVSTEPNGDHAPNTVDPSDTFGNSKGLTLSKREQLPFHSPSKAPSLL
QPSAQQSSPGPHRTTKSPSAWSDKMSMSRPTPTRRTSPQVRIPPKPSSSALAYATSKTGL
VYDPRMRFHAELPDMNINPDDIHPEDPRRIHSIFEEIKQAGLVASSTSEEDQQDHCWRIA
TRFATKPEILLIHTEEHYDFLKEQAEGLDSIYFNHSTYECAKLAAGGAIEACKAVVEGHV
RNAIAIIRPPGHHAETDSPSGFCIFNNVPIATRVCQKAYPETCRKVLILDWDVHHGNGIQ
HAFYDDPNVLYISLHVFKDGNFYPNLPDGNLNYCGEGLGEGKNVNIPWAEHGMGDAEYLY
AFQEVVMPIATEFDPDLVIISAGFDAAEGDLLGGCFVTPACYGHMTHMLMRLAKGKLVVC
LEGGYNLRSIARSALAVTRVLMLEPPDRLHIDLPGPKDSAVHTVENVKREHSRYWKSLYP
KHLDKADPGYKDACRLHEIIREWQSRRLASEHSMVPLPPLYINKAGLTQTFSHNIIATPR
FMDRYPLLVIFHDPPGFQDHPDPVTGKNELHNTWLTDVTKRYIDWAITNDFQVIDVNIPK
IVTVEDADYGFVRADDSTVRARQTRELATYLWENYIEPNEASQVFFMGIGDAYLGLVDLL
SHNENCTDPGSRVECLIGFVAETTIQSIKRAADDFISTWYYEHSMIFVKDSHFVWDPSRQ
RKVRKKLGNLRKSPKDTLDEMLEEHLEEVQAMLLRKKSELDEMSDISSRTDDGPQAMDTG
LRSPPLPIASQTPKHFEAGGRQENASKLLRSPNMPTVGAGEMQKLGTRLRTRQVVSSSLA
DKDFLSHHPRARLQALQHNLTPHASHGYLGRKKSMLSQATDAPR

BLAST