GenomeNet

>pte:PTT_14436 hypothetical protein; K00235 succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1] (A)
MACTRALTRLATKRIAVRPAVFSRGFASVNDVHARDPISKTAEKIVPDAARPTIPESKTS
TVQEPSPSKDAKTKTFHIYRWNPDEPTSKPKMQSYTLDLNKTGPMMLDALIRIKNEVDPT
LTFRRSCREGICGSCAMNIDGVNTLACLCRIPTDTTKESRIYPLPHMYVVKDLVPDMTLF
YKQYRSVKPYLQRTTAAPDGREFRQSKEDRKKLDGLYECILCACCSTSCPSYWWNQEEYL
GPAVLLQSYRWIADSRDEKKAERQDALNNSMSLYRCHTILNCSRTCPKGLNPALAIAEIK
KSMAFT

BLAST