GenomeNet

>pte:PTT_16448 K01176 alpha-amylase [EC:3.2.1.1] | (RefSeq) hypothetical protein (A)
MSSEEQKPTPENKTLFQGFEWNVPDDHKHWKRLAEQVPKLKAIGISNIWLPPGCKAANPK
GVGYDIYDLYDLGEFDQKGGKGTKWGTKEELLELAKVAKEHGVGLYWDAVLNHKAGADRT
EKCRVIEVDQNDRTKEVGEAYEIEGWLGFDFPGRGEQYSAQKYHWEHFSGTDYNQANEKK
AIYKILGDNKGWSSTVDDEQGNADYMMFADIDYSHPEVQEDVKNWGVWITKELGLKGFRL
DAVQHFSSRFTNTWIDNLREQCGDDVFVVGEFWSGDVQIMSDWLDKMSHKFALYDSPLLN
NFGTLSTTEKADLRTVFDKTLVQIRPTDAVTVVTNHDTQPGQVMETKIEGFFKPLAYALI
LLRHDGYPCPFYGDLYGLAEPHETPASCGGKLADLILARKLFAYGDQEDYFNEANCIGFV
RRGTWDKKAGLACVMSNAGPGEIKMAVGEMHAGQKWTDVLGWEEGEVEIDAEGYGVFRCS
GTSVSVWVRGDAEGREQFPTKFDADVYGK

BLAST