GenomeNet

>pte:PTT_18747 K04564 superoxide dismutase, Fe-Mn family [EC:1.15.1.1] | (RefSeq) hypothetical protein (A)
MSAPQYTLPPLPYAYDALEPHISAQIMELHHSKHHQTYITNLNGLLKTQAEAVTTSDITS
QVSIQQGIKFNAGGHINHSLFWQNLAPASSSEAKSSAAPGLLSQIKATWGDEDKFKEAFN
AALLSIQGSGWGWLVKTEIGKEQRLSIVTTKDQDPVVGKGEVPIFGVDMWEHAYYLQYQN
GKAAYVKNIWNVINWKTAEERYLGSRADAFSVLKASI

BLAST