GenomeNet

>pth:PTH_1243 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) CDC9; ATP-dependent DNA ligase (A)
MSDGSLPLLRPMLAVSSRPFDSAEYIYEVKWDGYRGLCYLDGNTVIRSRNLADLTGKFPE
LAGMHRKVSRKPAILDGEIVLFEKGKPSFAGLQSRGKISELKSISRASAERPVIFIAFDV
LYCGGKSVMGLSLIERKRLLEEMVGTGEELVLSRYICGEGRKFFEACVKEGLEGAVAKKL
NSVYLPGRRSAYWLKFRHTKEADLVICGYQYGPGGKNLGCLVLGGYHNGRLVYQGKVGTG
FSSEEANALLEGLRRLEVAGETLQVPRAEKSRTRWVRPLLVCAVEYLEATAGGCLRHPVY
RGLRRDKTPAECPAVAIKVWLDGT

BLAST