GenomeNet

>pti:PHATRDRAFT_16875 K11423 histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43] | (RefSeq) hypothetical protein (A)
CPKTCPGDMFCGNRRITNGEFRTVRVVEAGRKGRGLVVEEDVDVGDMILEYVGRAVPQKQ
LAKYFRRYQHDRRLYIMSLGDGIYIDARSKGGLARYINHSCEPNCQVQRWKVKGVLRAVV
VPTRSLSAGTELTFDYQWERQRGRAATKCYCGTPSCRGTLEVIP

BLAST