GenomeNet

>pti:PHATRDRAFT_34010 K00814 alanine transaminase [EC:2.6.1.2] | (RefSeq) hypothetical protein (A)
MYPGLRKMEYAVRGKVVIAADQISDNLASGKSYPFDHIVYTNIGNPQSVGQQPLTWPRQV
LALVDLPDAVGIQHPDILRLFPADAVARAKEIKEGLGGHGSGAYSHSKGCRAFRRDIAAF
LQDRDGGLPAEPEDIFMTNGASAGINMMLNALVADSSCGVMIPIPQYPIYSATIDLLGGQ
KVGYYLNEANGWELNMEELERSLQEATEQGIKVNAFVLINPGNPSGTVLSRTNLQDIVRF
CAKHNLVLLADEVYQENVYDENAEFVSCKRAAHQVGLLEDDGIELVSFHSISKGVFGECG
RRGGYMELVGFNADVKDELYKLASANLCATVSGQIMTSLMVRGPDQGDVSYESHQAEKKA
IFESLRRRSKIVSDGLNNIPGISCQTATGSMYCFPSVEMPKGALPAAEKMGVSPDTLYCM
SLLERTGLCVVPASGFGQREGRYGFRTTFLPSEDEMARAVEQIREHYHEFCEMYA

BLAST