GenomeNet

>pti:PHATRDRAFT_49800 histone deacetylase 1 isoform; K06067 histone deacetylase 1/2 [EC:3.5.1.98] (A)
MTGKSRVSYFYHPTCPLFYYGPSHPMKPHRLKLAHHLILTYGLYKEMDCYRPHPAAAGEM
TQFHSEDYVNFMSKVTPDNLRQYSASMQRFNAGDSTDCPVFDGLFEFTQLYTGSSLDGAL
QLCQGNTDIAINWSGGLHHAKKGEASGFCYINDIVLAILELLKVHARVLYVDIDVHHGDG
VEEAFYTTDRVMTFSIHKYGDFFPGTGHISDTGAKDGTGFSVNAPLNSGITDETYFHDLF
KPVMEKIMQVFNPGAVVLQCGADSLTGDRLGCFNLTLKGHAACVEYVKSFGVPTLVLGGG
GYTIRNVARCWAYETAVLLDKKDIPNEIPYNDYYEYYAPDYELHLTPTPEENMNGKDALE
DVRTELLQQLQDLQGAPSVAMQQVPPSFQRAEATEEDPDVREGASKTRSGDGVRKQHPSE
LYDEVD

BLAST